WWW.LI.I-DOCX.RU
БЕСПЛАТНАЯ  ИНТЕРНЕТ  БИБЛИОТЕКА - Различные ресурсы
 

«МИНИСТЕРСТВО ОБРАЗОВАНИЯ И НАУКИ РОССИЙСКОЙ ФЕДЕРАЦИИ ФГАОУ ВО Новосибирский национальный исследовательский государственный университет Факультет естественных наук «УТВЕРЖДАЮ» Декан ФЕН НГУ, ...»

МИНИСТЕРСТВО ОБРАЗОВАНИЯ И НАУКИ РОССИЙСКОЙ ФЕДЕРАЦИИ

ФГАОУ ВО "Новосибирский национальный исследовательский государственный университет"

Факультет естественных наук

«УТВЕРЖДАЮ»

Декан ФЕН НГУ, профессор

_______________Резников В.А.

«29» августа 2014 г.

Рабочая программа дисциплины

Биоинформатика

и функциональная

геномикаНаправление подготовки

Биология 020400

Квалификация (степень) выпускника

Магистр

Форма обучения

Очная

Новосибирск 2014

Аннотация рабочей программы

Дисциплина «Биоинформатика и функциональная геномика» является вариативной частью математического и естественно-научного цикла, дисциплиной по выбору М2.В.ДВ.2 ООП Магистратуры по направлению подготовки «Биология». Дисциплина реализуется на факультете естественных наук Национального исследовательского университета Новосибирский государственный университет кафедрой цитологии и генетики ФЕН НГУ для магистрантов 1 курса.

Содержание дисциплины охватывает обзор базовых инструментов и информационных ресурсов по биоинформатике и функциональной геномике. Рассматриваются основные вопросы и методы их решения в геномике, транскриптомике и протеомике. Приобретенные навыки применяются на практике для решения задач генетики и эволюционной биологии.

Дисциплина нацелена на формирование общекультурных компетенций ОК-1, ОК-2, ОК-3, ОК-6, профессиональных компетенций ПК-1, ПК-2, ПК-6, ПК-13 выпускника.



Преподавание дисциплины предусматривает следующие формы организации учебного процесса: 30 ч. – лекции, из них 18 в интерактивной форме, 36 ч. - самостоятельная работа студента, 6 ч. - контроль (контрольное задание и коллоквиум).

Программой дисциплины предусмотрены следующие виды контроля: текущий контроль осуществляется по посещению занятий, выполнению заданий и их представлению на коллоквиуме, рубежный контроль - дифференцированный зачет.

Общая трудоемкость дисциплины составляет 2 зачетных единиц, 72 академических часа.

1. Цели освоения дисциплины

Курс биоинформатики и функциональной геномики необходим для обучения студентов современным компьютерным методам сбора и анализа биологических данных. Биоинформатический анализ является обязательным этапом исследований в целом ряде задач биологии, медицины и сельского хозяйства. Знания и практические навыки, полученные студентами в рамках курса, помогут проводить эффективный поиск биологической информации, анализ и сравнение генетических данных, исследование филогении, генерацию гипотез о механизмах молекулярно-генетических процессов на основе биоинформатического анализа и многое другое.

Для достижения поставленной цели выделяются задачи курса:

Ознакомление с основными информационными ресурсами биологии и медицины.

Обзор базовых биоинформатических методов и алгоритмов анализа биологических данных.

Обзор успешных примеров генерации гипотез о механизмах молекулярно-генетических процессов с использованием методов биоинформатики и функциональной геномики.

Практическая работа с онлайн биоинформатическими ресурсами для решения конкретных биологических задач.

Курс ставит своей целью ознакомление студентов с богатством и многообразием доступных через интернет биологических данных, с возможностями их биоинформатического анализа с применением доступных онлайн программ. В рамках курса подробно разбираются основные базы данных по биологии и медицине и встроенные в них программы биоинформатического анализа.





Данный курс знакомит студента с методологией теоретического анализа полногеномных данных. Подробно разбираются все этапы теоретического анализа: поиск и доступ к информации, методы биоинформатического анализа данных, интеграция и сравнение данных разных типов экспериментов, генерация гипотез о механизмах молекулярно-генетических процессов. Отдельное внимание уделяется принципам и примерам филогенетического анализа.

В рамках курса большое внимание уделяется освоению теоретических знаний на практике, практические задания, предлагаемые студентам позволяют познакомиться со всеми рассмотренными в рамках лекционного курса базами данных и алгоритмами на практике и закрепить приобретенные навыки при работе над курсовой работой. Несмотря на то, что ключевым вопросом данного курса является вопрос «Как?», разбор конкретных практических задач позволяет студенту разобраться в вопросах «Зачем?» и «Почему?».

2. Место дисциплины в структуре ООП бакалавриатаДисциплина «Биоинформатика и функциональная геномика» входит в базовую частью профессионального цикла, ООП по направлению подготовки «Биология».

Дисциплина «Биоинформатика и функциональная геномика» опирается на следующие дисциплины Бакалавриата:

Молекулярная биология;

Матстатистика и теория вероятности;

Генетика;

Биометрия;

Теория эволюции

Результаты освоения дисциплины «Биоинформатика и функциональная геномика» используются в следующих дисциплинах данной ООП:

дисциплинах специализации других профилей;

анализ и обсуждение результатов при выполнении дипломной работы и подготовке публикаций.

3. Компетенции обучающегося, формируемые в результате освоения дисциплины «Генетика»:

Общекультурные компетенции:

способность к творчеству (креативность) и системному мышлению (ОК-1);

способность к инновационной деятельности (ОК-2);

способность к адаптации и повышению своего научного и культурного уровня (ОК-3);

способность самостоятельно приобретать с помощью информационных технологий и использовать в практической деятельности новые знания и умения, в том числе в новых областях знаний, непосредственно не связанных со сферой деятельности (ОК-6).

Профессиональные компетенции:

понимание современных проблемы биологии и использование фундаментальных биологических представлений в сфере профессиональной деятельности для постановки и решения новых задач (ПК-1);

знание и использование основных теорий, концепции и принципов в избранной области деятельности, способность к системному мышлению (ПК-2);

творчески применяет современные компьютерные технологии при сборе, хранении, обработке, анализе и передаче биологической информации (ПК-6);

самостоятельно использует современные компьютерные технологии для решения научно-исследовательских и производственно-технологических задач профессиональной деятельности, для сбора и анализа биологической информации (ПК-13).

В результате освоения дисциплины обучающийся должен:

иметь представление об основных информационных ресурсах биологии и медицины, особенностях доступа к этим данным и возможностях их биоформатического анализа;

уметь профессионально пользоваться GenBank и UCSC Genome Browser;

понимать принципы, лежащие в основе алгоритмов сравнения биологических последовательностей, знать и уметь профессионально пользоваться программой BLAST;

понимать принципы филогенетического анализа, уметь строить и анализировать филогенетические деревья;

Иметь представления о современных методах анализа экспрессии генов, уметь проводить статистический анализ и функциональную аннотацию этих данных;

Понимать возможности и недостатки программ предсказания в биологии и медицине, знать спектр таких программ и уметь ими пользоваться;

Знать основные ресурсы по протеомике, понимать возможности и недостатки современных методов анализа функций белков.

4. Структура и содержание дисциплины

Структура дисциплины: 30 ч. лекции в компьютерном классе с интерактивными общением и консультациями, контрольные задания, самостоятельная работа студента. Текущий контроль осуществляется по посещению занятий, выполнению заданий. Итоговый контроль - дифференцированный зачет. Общая трудоемкость дисциплины составляет 2 зачетных единиц, 72 часа.

№ п/пРаздел дисциплины Семестр Неделя семестра Виды учебной работы, включая самостоятельную работу студентов и трудоемкость

(в часах) Формы текущего контроля успеваемости (по неделям семестра)

Форма промежуточной аттестации (по семестрам)

Лекция Лабор. работа Самост. работа Контр. работа Зачет 1.1. Введение в биоинформатику и функциональную геномику. Основные задачи и набор инструментов. 2 1 2 1.2. Банки данных биологических последовательностей. Геномные браузеры. GenBank. 2 2 3 1 Контрольное задание

2.1 Сравнение нуклеотидных и белковых последовательностей. Попарное выравнивание. BLAST. 2 3 3 2.2. «Продвинутый» поиск гомологичных последовательностей. PSI-BLAST, MegaBLAST, BLASTZ, BLAT. Скрытые марковские модели. 2 4 4 1 Контрольное задание

2.3. Множественное выравнивание последовательностей: основные алгоритмы и их особенности. ClustalW, MAFFT, MUSCLE и другие методы. 2 3 4 1 Контрольное задание

3.1. Молекулярная филогения и эволюция. Ортологи и паралоги. Филогенетические деревья и алгоритмы их построения и анализа. 2 3 4 1 Контрольное задание

3.2. Молекулярная филогения и эволюция. Модели эволюции. Гипотеза молекулярных часов. Скорости замен и время дивергенции. 2 2 4 4. Методы предсказания в биологии. Поиск сигналов в нуклеотидных последовательностях. Распознавание сайтов связывания транскрипционных факторов. 2 4 4 1 Контрольное задание

5. Транскриптомика. Особенности анализа полногеномных данных по экспрессии генов. Статистические методы обработки данных микрочип экспериментов. 2 4 4 6. Протеомика. Специализированные базы данных по белкам. Белковые семейства (домены и мотивы). Поиск и предсказание физических свойств белков. 2 4 4 1 Контрольное задание

1.11 ИТОГО 30 36 6 Диф.зачетПрограмма практических занятий по биоинформатике и функциональной геномикеЗанятия 1-2.

Знакомство с банком данных NCBI. Реализация простых и сложных запросов. Поиск информации в системе Entrez. Проект RefSeq. Поиск научной литературы в PubMed. Генная онтология (GO Ontology) и функциональный анализ генов в системе AmiGO. Геномный браузер UCSC.

Практическое задание 1.

Используя систему поиска Entrez оцените количество глобинов в геноме человека? Найдите прототипную (репрезентативную) последовательность нейроглобина.

Практическое задание 2.

Используя систему поиска Entrez оцените количество белков человека, которые имеют массу более 300 000 дальтон.

Практическое задание 3.

ATP-binding cassette (ABC) - пример белкового домена в широко-представленном семействе ABC transporters. Используя систему поиска Entrez оцените количество белков человека, которые имеют такой домен? Сколько белков бактерий имеют такой домен?

Практическое задание 4.

Используя базу данных PheGenI для поиска генов и систему AmiGO для функциональной аннотации генов найдите в каких молекулярных процессах задействованы гены, которые были ранее ассоциированы с такими заболеваниями, как:

Депрессия

Астма

Практическое задание 5.

Используя геномный браузер UCSC

Найдите ген бета-глобинаКакие гены находятся справа и слева от гена?

Просмотрите, какие мРНК из GenBank экспрессируются в этом локусе. Что за транскрипты М12050 и М14754?

Какие альтернативные изоформы HBB предсказывают программы AceView и Ensembl 68?

Сайты связывания каких транскрипционных факторов были локализованы в промоторе HBB методом ChipSeq? А в downstream районе HBB?

Просмотрите какие трэки можно открыть по экспрессии и регуляции?

Добавьте новый трэк «Burge lab RNA-seq aligned by GEM Mapper». В какой из исследованных тканей GEM Mapper распознает самую длинную изоформу.Занятия 3-4.

Обзор основных алгоритмов попарного глобального и локального выравнивания.

Использование программы BLAST и ее модификаций.

Практическое задание 1.

В геноме человека есть гомологи обратной транскриптазы pol, которую кодирует вирус HIV-1. Попробуйте найти этих гомологов в Entrez protein.

Accession number HIV-1 reverse transcriptase NP_057849. Используйте программу blastp для поиска гомологов. Какие результаты вы получаете с матрицами BLOSUM62, BLOSUM50, BLOSUM90?

Что изменяется при использовании PAM30, PAM70, PAM250?

Представьте результаты в виде таблицы

Практическое задание 2.

Сравните митохондриальную ДНК современного человека с ДНК неандертальца. Используйте последовательность гена cytochrome oxidase.

Практическое задание 3.

На лекции мы видели, что некоторые гены эволюционируют медленно (убиквитин). А как быстро эволюционируют цитохром оксидаза из предыдущего задания? Какова степень гомологии у гена человека, гена крысы и гена мыши?

Для ответа на этот вопрос используйте попарное выравнивание в программе blastp.

Практическое задание 4.

В программе blastp проведите поиск белка длиной 12 аминокислот: PNLHGLFGRKTG. Программа BLAST автоматически подстроит параметры под короткую последовательность.

Как изменятся следующие параметры: матрица для оценки скора, «длина слова», порог e-value?

Какое наибольшее e-value выдается для 100 наиболее хороших выравниваний?

Охарактеризуйте наилучшее выравнивание в запросе (e-value, процент гомологии, скор).

Практическое задание 5.

Поиск с белковыми последовательностями как правило более информативен, чем поиск с последовательностями ДНК. Проверьте это утверждение.

Проведите поиск в программе blastp с последовательностью белка RBP4 (NP_006735), ограничьте поиск по классу насекомые.

Проведите тот же поиск в программе blastn для кодирующей части (CDS) гена RBP4 (NM_006744).

Какое количество выравниваний вы получили для каждого случая с E value<1.0.

Практическое задание 6.

Olfactory receptor family – одно из самых больших семейств генов человека. Используйте программу BLAST для оценки количества паралогов.

Практическое задание 7.

“The Icemen” – человек который жил 5300 лет назад, его тело обнаружили в Итальянских Альпах в 1991 году. С одежды этого человека были получены остатки грибков. К каким современным видам ближе всего последовательности этих грибов?

Практическое задание 8.

У малярийного плазмодия Plasmodium vivax есть специфичное семейство генов vir. Есть около 1000 копий этого гена. Используйте поиск blastp для поиска паралогов vir1. Затем проведите поиск в программе PSI-BLAST:

При первоначальном поиске, сколько белков имеют E value менее 0.005?

Каков скор наилучшего нового выравнивания полученного на второй итерации?Сколько белков найдено после 3 итерации?

Практическое задание 9.

Существуют ли глобины в грибах?

Проведите поиск в PSI-BLAST и Delta-BLAST с использованием последовательности человеческого beta globin (NP_000509).

Какова длина глобинов в грибах? Какие неглобиновые домены иногда присутствуют у ортологов гемоглобина?

Занятие 5-6.

Обзор материалов и методов по множественному выравниванию последовательностей. Получение из базы данных NCBI выборки последовательностей для множественного выравнивания. Филогенетический анализ.

Практическое задание 1.

Поиск в NCBI группы последовательностей для множественного выравнивания(вариант 1 - HomoloGene).

Используйте для поиска ключевые слова, например «cytochrome» (ferritin,S100, trypsine или ген вашего интереса)

Используйте HomoloGene.

Выберите вид- «множественное выравнивание»

Выберите одно из выравниваний, содержащее гэпы (для следующего задания)

Выберите вид «FASTA»

Скопируйте в текстовый документ.

Практическое задание 2.

Поиск в NCBI группы последовательностей для множественного выравнивания. Повторите поиск с использованием базы данных CDD.

Практическое задание 3.

Поиск в NCBI группы последовательностей для множественного выравнивания. Повторите поиск с использованием BLAST.

Практическое задание 4.

Сравните множественные выравнивания последовательностей из заданиq 1-3.

Используйте ClustalW, MAFFT, Muscle и T-Coffee

Сравните качество выравниваний, положение и размер гэпов.

Измените штраф за гэп (два раза – увеличить и уменьшить - на примере одного метода). Как это влияет на выравнивание?

Измените число итераций и матрицу замен (на примере одного итеративного метода). Как влияет число итераций на выравнивание? А матрица?

Запустите для одного из методов JalView (summary> JalView). Оцените, как связано качество выравнивания консервативность и консенсус. Почему?

Практическое задание 5.

Используйте ClustalW для множественного выравнивания двух наборов по 5 последовательностей – близкородственных и далёких.

Можно использовать пример из лекций (файлы 3 и 4) или выбрать последоватльности из заданий 1-3.

Для каждого (из двух) наборов сделать множественное выравнивание. Сохранить его или оставить открытым.

Затем добавьте в набор близких последовательностей пять копий одной из них (для примера из лекций – белка курицы).

Сделайте новое множественное выравнивание и сравните с исходным.

То же проделайте с набором «далёких» глобинов. Обратите внимание на положение гэпов.

Практическое задание 6.

Используйте T-Coffee (tcoffee.org) или другую программу по выбору для множественного выравнивания набора из 5 последовательностей липокалинов из файла. Он включает человеческий RBP и Крысиный OBP.

Скопировать в текстовом виде вывод в формате ClustalW и вставить в iRMSD-APDB (tcoffee.org) чтобы учесть структурную информацию.

Как изменился скор и цветовая карта (heatmap)? Почему?

Повторить выравнивание в expresso (tcoffee.org).

Как изменился скор и цветовая карта (heatmap)? Почему?

Практическое задание 7.

X-linked адренокортикодистрофия (X-ALD) наиболее распространённое наследственное заболевание, связанное с пероксисомами (субклеточные единицы, которые вовлечены в метаболизм жиров и другие процссы). Заболевание вызвано мутацией в гене ABCD1, кодирующем ALD белок (ALDP). У людей найдено 4 ALDP-related белка в пероксисомах: ALDP (NP_000024; 745 а.о.), ALDR (NP_005155, 740 а.о.), PMP70 (NP_002849, 659 а.о.), and PMP70R (NP_005041, 606 а.о.). Два дрожжевых ALDP-like белка также были идентифицированы: Pxa1p (NP_015178) и Pxa2p (NP_012733). Эти белки – часть обширного семейства ATP-binding cassette (ABC) transporters, включающего также ассоциированные с заболеваниями последовательности (the cystic fibrosis transmembrane regulator (CFTR)) и белки устойчивости к ядовитым соединениям (multidrug-resistant proteins (MDR)).

Создайте множественное выравнивание человеческого, мышиного и дрожжевого представителей ALDP семейства белков.

Выявите консервативный нуклеотид-связывающий район, GPNGCGKS.

Этот мотив идеально консервативен?

Занятие 7-8.

Практические приёмы молекулярной филогении в MEGA.

Практическое задание 1.

Сравнение скоростей накопления замен в митохондриальных последовательностях человека и шимпанзе.

Запустите MEGA

Скопируйте из файла 1 митохондриальные последовательности человекообразных обезьян и сделайте множественное выравнивание в MEGA. Для этого:

Запустите MEGA Alignment explorer из выпадающего меню “Alignment”

Если последовательности не загрузились автоматически – вставьте их в открывшееся окно

В меню “Alignment” этого окна выберите Align by ClustalWСохраните сессию и данные (меню «файл»- «сохранить» и «экспорт», форматы.mas и.meg).Закройте Alignment explorer

Откройте файл.meg в MEGA

Изучите меню Phylogeny. Какие методы вы узнаёте?

Используйте метод ближайшего соседа (NJ) для установления филогенетических взаимоотношений.

Какой таксон можно использовать в качестве аутгруппы при сравнении скоростей накопления замен между эволюционными линиями человеком и шимпанзе?

Выберите в меню Tajima’s test.

Выберите человека, шимпанзе и вашу аутгруппу.

Оцените значение 2 и P-value. Что можно сказать о скоростях накопления замен?

Сформируйте свою выборку (5-6 последовательностей) и проанализируйте равенство скоростей накопления замен.

Практическое задание 2.

Сравнение результатов использования разных методов построения филогенетического дерева.

Откройте файл.meg из задания 1 c митохондриальными последовательностями в MEGA

Используйте методы ближайшего соседа (NJ), Maximum Parsimony, и UPGMA для установления филогенетических взаимоотношений.

Используйте для запуска методов построения дерева вкладку меню «Phylogeny > Bootstrap test phylogeny» чтобы провести бутстрэп анализ.

Сравните топологи деревьев и бутстрэп поддержку. Что выможете сказать о надёжности узлов ветвления?

Изучите меню вида дерева (см. следующий слайд). Изучите как выглядит дерево классической угловой и гладкой формы, а также радиальное и круговое. Какая форма кажется вам более наглядной?

Для результата метода Maximum Parsimony (или любого другого) разрешите мультиветвистые узлы с порогом отсечения 70. Что изменилось? О чём это говорит?

Практическое задание 3.

Построение филогенетических деревьев.

ОткройтеNCBI и найдите в Conserved Domain Database характерные домены Lipocalin (globin или ген вашего интереса)

Выберите домен и перформатируйте набор последовательностей в mFasta.

Сохраните в файл.txt. (20 последовательностей)

Найдите в NCBI видовую принадлежность последовательностей и отметьте это в названии.

Используйте метод ближайшего соседа (NJ) или UPGMA и Maximum Parsimony для установления филогенетических взаимоотношений. (здесь также нужна бутстрэп-поддержка)

Изучите меню как выглядит дерево классической формы, а также радиальное и круговое. Какая форма теперь кажется вам более наглядной? Включите мультиветвистые узлы. Что изменилось?

Как полученные древа согласуются друг с другом и с вашими знаниями о филогении организмов?

Занятие 9.

Разбор принципов, лежащих в основе создание методов распознавания. Обзор программ и методов распознавания сайтов связывания транскрипционных факторов.

Практическое задание 1.

Предложите алгоритм поиска CpG островков в геноме.

Практическое задание 2.

Проведите распознавание физико-химических особенностей в тестовой выборке сайтов для E2F/D транскрипционного фактора в программе SITECON

http://wwwmgs.bionet.nsc.ru/cgi-bin/mgs/sitecon/sitecon.pl?stage=0Сколько сайтов нашлось в выборке? Рассмотрите физико-химические особенности E2F/D сайта (map of conservative properties). Какая длина кора этого сайта? Опишите каковы особенности в изменении свободной энергии (Free energy change) в коре этого ССТФ?

Практическое задание 3.

Используя ту же выборку последовательностей проведите распознавание в программе MEME Suite.

Для этого увеличьте параметр Maximum widthдо 300.Совпадают ли какие-либо из найденных мотивов с теми, которые вы нашли программой Sitecon?

С помощью программы TOMTOM проверьте на какие сайты связывания похож мотив 3?

Занятие 10.

Анализ данных полногеномных экспериментов по исследованию экспрессии генов. Разбор отличий между данными экспериментов микрочип и RNA-Seq.

Практическое задание:

Скачайте данные микрочип эксперимента GDS1761 из базы данных GEO. Это эксперимент по исследованию экспрессии генов в разнообразных раковых опухолях. Предобработанный файл имеет расширение SOFT.

В шапке файла указано описание того, какие данные содержатся в колонках. Сохраните это описание в отдельный файл. И удалите в файле *.SOFT все до строки «!dataset_table_begin» (включительно)

Откройте получившийся файл в Excel, сохраните его.

Оставьте данные только для образцов меланомы и лейкемии, остальные столбцы удалите (Столбец с названием гена надо оставить). Сколько образцов исследовано для каждого из видов рака?

Заведите отдельные колонки, в которых рассчитайте среднее значение уровня экспрессии генов для каждого из типов рака, а также их отношение.

Экспрессия скольких генов изменилась более чем в два раза?

Сравните достоверность различий экспрессии генов в этих образцах при помощи теста стьюдента (=ТТЕСТ). Результаты сохраните в отдельной колонке.

Экспрессия скольких генов значимо отличается в этих видах рака p-value <0,05? Используйте функцию =СЧЁТЕСЛИ(диапазон;"<0,05").

Изменения экспрессии скольких генов удовлетворяет критерию Бонферони для p value<0.5? Сколько из них изменили экспрессию более чем в два раза? Что это за гены?

Постройте диаграмму рассеяния для средних значений экспрессии в каждом из типов рака.

Наибольшая дисперсия наблюдается в области отрицательных значений по обоим образцам. С чем это может быть связано?

Визуально, что наблюдается чаще: экспрессия гена подавлена при лейкемии, но активирована при меланоме, или наоборот?

Исследуйте выборку генов, которые более в два раза уменьшили свою экспрессию в обоих типах рака для анализа в базе данных DAVID.

http://david.abcc.ncifcrf.gov/

Занятие 11.

Разбор баз данных в протеомике, их содержания и возможностей. Интерактивное занятие, идет параллельно с лекцией.

Практическое задание 1

Используя базу данных Entrez Protein NCBI, найдите следующую информацию для белка HBB:

Последовательность белка в FASTA формате;

Какова длина белка?

Какая модификация была найдена в позиции 142 и из какого ресурса взята эта информация?

Какие позиции белка образуют активный сайт для связывания с гемом?

Сколько сайтов гликозилирования показано в белке? И из какого ресурса взяты эти данные?

Перейдите по ссылке в базу данных OMIM (/db_xref="MIM:). С какими болезнями ассоциирован белок? Что известно о связи этого гена с малярией?

Перейдите по ссылке в Protein 3D Structure. Выберите «Solution Structure of Human Normal Adult Hemoglobin». С какими белками взаимодействует белок HBB в этом комплексе?

Практическое задание 2

Сравните информацию, найденную в Entrez Protein NCBI по белку HBB с информацией из UniProt. Какую дополнительную информацию можно найти в UniProt?

Найдите информацию по белку RBP4 мыши в базе данных UniProt.

Скачайте последовательности в FASTA формате.

Какова длина белка?

Где локализуется белок?

С чем он может связываться?

Какие модификации этого белка были описаны?

Обратите внимание, какую информацию об этом белке вы сможете найти по ссылкам, перечисленным в UniProt.

Практическое задание 3

Найдите в базе данных CATH суперсемейство глобинов.

Рассмотрите классификацию глобинового домена CATH?

Какие еще семейства найдены в 1.10.490 globin-like?

Какой наименьший и наибольший глобиновый домен существует?

Используя закладку Multi Domain Organization, выясните какой дополнительный домен часто встречается в глобинах бактерий.

Практическое задание 4

Найдите в базе данных Pfam суперсемейство глобинов.

Что такое Leghaemoglobin?

Что такое Protoglobin?

В каком организме существует белок с 9 повторами глобинового домена

Рассмотрите профиль глобинового гена в HMM logo? Какие позиции наиболее консервативные?

Используйте HMM logo для идентификации последовательности:

MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Практическое задание 5

В онкогене человека jun проведите распознавание:

coil-coil домена;

сайтов фосфорилированияВторичную структуру

Рассмотрите структуру белка в базе данных PDB.

Практическое задание 6

Исследуйте доменную организацию белка HIV-1 gag-pol.

Используйте базу данных PDB, идентификатор 4B3O.

Какие домены присутствуют в белке gag-pol?

Какие домены и мотивы присутствуют в обратной транскриптазе этого белка?

Какие модификации обратной транскриптазы описаны?

Расcмотрите 3D структуру комплекса обратной транскриптазы с ДНК, сохраните изображение.

Образовательные технологии

Используется интерактивная система лекций и практических занятий в компьютерном классе. Это позволяет наилучшим образом освоить материал и получить навыки биоифнорматического анализа данных. Проводится обсуждение нового материала и решение простых задач, в том числе в форме case-study (анализ реальных проблемных ситуаций и поиск решений). Кроме того, студенту предлагается в рамках занятий выполнить биоинформатическую часть его дипломного проекта. Основное требование – использование и отработка всех навыков, освоенных в рамках курса.

6. Учебно-методическое обеспечение самостоятельной работы студентов. Оценочные средства для текущего контроля успеваемости, промежуточной аттестации по итогам освоения дисциплины

Контроль работы студентов проводится по выполнению практических заданий, которые выполняются на практических занятиях, либо самостоятельно. Дифференциальный зачет студентов проводится на основе посещаемости лекций, выполнения практических заданий, выполнения курсовой и представлении ее на коллоквиуме. На коллоквиуме студенты представляют свои курсовые вопросы, задают вопросы и отвечают на них. Выполнение всех практических заданий является необходимым условием получение оценки «хорошо». Правильно выполненная и хорошо представленная курсовая работа является необходимым условием оценки «отлично».

7. Учебно-методическое и информационное обеспечение дисциплины

а) основная литература:

Jonathan Pevsner. Bioinformatics and Functional Genomics. John Wiley & Sons, Inc. 2011.

Р. Дурбин, Ш. Эдди, А. Крог, Г. Митчисон. Анализ биологических последовательностей. М.-Ижевск, 2006.

б) дополнительная литература:

А. Леск. Введение в биоинформатику. М., Бином, 2009.

в) программное обеспечение и Интернет-ресурсы:

Сайт книги Jonathan Pevsner. Bioinformatics and Functional Genomics. http://www.bioinfbook.orgВведение в биоинформатику. Интерактивный курс А.Л. Лапидус (СПбГУ) на ресурсе Coursera. https://www.coursera.org/course/bioinfo8. Материально-техническое обеспечение дисциплины

Ноутбук, медиа-проектор, экран и программное обеспечение для демонстрации слайд-презентаций.

Персональные компьютеры для выполнения студентами практических занятий.

Программа составлена в соответствии с требованиями ФГОС ВПО с учетом рекомендаций и ПрООП ВПО по направлению подготовки 020400 Биология (квалификация «Магистр»)

Авторы: Миронова Виктория Владимировна,

канд. биол. наук, ассистент КЦГ ФЕН НГУ,

зав. сек. ИЦиГ СО РАН

Колчанов Николай Александрович,

докт. биол.наук, проф. КЦГ ФЕН НГУ,

директор ИЦиГ СО РАН

Программа рассмотрена и одобрена на заседании кафедры цитологии и генетики ФЕН НГУ

от « 29_» августа 2014 года, протокол № _4___

Секретарь кафедры к.б.н. ______________________ А.Д. Брошков

Похожие работы:

«МБОУ Малозиновьевская основная общеобразовательная школа Урожайность разных сортов картофеля, выращенных на пришкольном участке Исследовательская работа по биологии Выполнили: ученицы 8 класса Шоронова Анна Кузьмичева Надежда Руководитель: Акишенкова З. М. Д.Малое Зиновьево2012г. Содержание Введение..3стр. Практическая част...»

«МИНИСТЕРСТВО ПРИРОДНЫХ РЕСУРСОВ И ЭКОЛОГИИ РОССИЙСКОЙ ФЕДЕРАЦИИФЕДЕРАЛЬНАЯ СЛУЖБА ПО ГИДРОМЕТЕОРОЛОГИИ И МОНИТОРИНГУ ОКРУЖАЮЩЕЙ СРЕДЫ Федеральное государственное бюджетное учреждение "Всероссийский научно-исследовательский институт гидрометеорологической...»

«УДК 33:66 Экономическая эффективность плазмохимического метода переработки промышленных и бытовых отходов В.Ю. Рогов, А.В. Зарецкий, Ж.И. Лобанова, М.А. Макаров Национальный исследовательский Иркутский государственный технический университет, 664074, г. Иркутск, ул. Лермонтова, 83. С каждым днем становится все актуальней...»

«МИНИСТЕРСТВО СЕЛЬСКОГО ХОЗЯЙСТВА РОССИЙСКОЙ ФЕДЕРАЦИИ Федеральное государственное бюджетное образовательное учреждение высшего профессионального образования"КУБАНСКИЙ ГОСУДАРСТВЕННЫЙ АГРАРНЫЙ УНИВЕРС...»

«Классификация наук по предмету исследования По предмету исследования все науки делятся на естественные, гуманитарные и технические. Естественные науки изучают явления, процессы и объекты материального мира. Этот мир иногда называется внешним миром. К данным нау...»

«Челябинская область Муниципальное бюджетное учреждение "Центр методического и хозяйственного обеспечения" от 12.12.2012г. Аналитическая справка по итогам проведения школьного этапа всероссийской олимпиады школьников в 2012-2013 уч. г.В период с 1 октября по 15 ноября на б...»

«Министерство образования Республики Беларусь Учреждение образования "Белорусский государственный университет информатики и радиоэлектроники" Кафедра производственной и экологической безопасностиОЦЕНКА РАДИОАКТИВНОГО ЗАГРЯЗНЕНИЯПРОДУКТОВ ПИТАНИЯ И СТРОИТЕЛЬНЫХ...»

«Тема : Что нас окружает. Живая и неживая природа, изделия человека. Цель: сформировать у учащихся понятия о живом и неживом в природе и о рукотворном мире ; формировать умения классифицировать предметы; формировать навык соотнесения реального об...»








 
2017 www.li.i-docx.ru - «Бесплатная электронная библиотека - различные ресурсы»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.